PTM Viewer PTM Viewer

AT1G07250.1

Arabidopsis thaliana [ath]

UDP-glucosyl transferase 71C4

6 PTM sites : 5 PTM types

PLAZA: AT1G07250
Gene Family: HOM05D000100
Other Names: UGT71C4

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

For each protein all PTMs are highlighted by default in the respective protein sequence (right-hand side). One can adjust a selection of PTMs in the PTM table on the left-hand side. In addition, functional protein domains and sites can be underlined if desired.

In the PTM table per PTM the PTM position and type is indicated, as well as the plain peptide sequence that was identified by mass spectrometry. The respective proteomics study is indicated by a number, providing a link to consult the experimental details. Additional PTM meta-data includes various confidence measures such as peptide score provided by search algorithms, posterior error probability (PEP), precursor mass deviation (in ppm) and modification site probability. The available confidence meta-data can be consulted in the extended PTM table by clicking SHOW CONFIDENCE. However, in the default PTM table, a color-coding of confidence is provided with green indicating high confidence, olive medium confidence, grey low confidence, and no color an unassigned confidence. More details regarding this confidence assignment can be consulted in the tutorial or the Plant PTM Viewer manuscript.

Besides confidence measures, log2 fold changes between two conditions with significance values (P- or Q-values) are shown if provided in the respective publication. Log2 fold changes are colored in heatmap-like gradient (green = induced, red = repressed) and significant values are highlighted in green. To determine significance, we employed the threshold used in the respective publication. For more details on the quantitative measurements we refer to the experimental details and respective publication, as methodologies can differ.

On the bottom of the page one can send the whole protein or a part of the protein (i.e. a functional domain) to PTM Blast. This will display aligned protein sequences that potentially report aligned PTMs.

PTMs



PTM Type

Mod AA

Pos

Peptide

Exp ID

Conf
ph T 320 TSGDVETNPNDVLPEGFMGRVAGR85
ph S 321 TSGDVETNPNDVLPEGFMGRVAGR85
sno C 423 GGLVTCDEIAR169
so C 423 GGLVTCDEIAR110
ac K 440 SLMDGGDEKR101
mox M 447 EMADAARK62a

Sequence

Length: 479

MVKETELIFIPVPSTGHILVHIEFAKRLINLDHRIHTITILNLSSPSSPHASVFARSLIASQPKIRLHDLPPIQDPPPFDLYQRAPEAYIVKLIKKNTPLIKDAVSSIVASRRGGSDSVQVAGLVLDLFCNSLVKDVGNELNLPSYIYLTCNARYLGMMKYIPDRHRKIASEFDLSSGDEELPVPGFINAIPTKFMPPGLFNKEAYEAYVELAPRFADAKGILVNSFTELEPHPFDYFSHLEKFPPVYPVGPILSLKDRASPNEEAVDRDQIVGWLDDQPESSVVFLCFGSRGSVDEPQVKEIARALELVGCRFLWSIRTSGDVETNPNDVLPEGFMGRVAGRGLVCGWAPQVEVLAHKAIGGFVSHCGWNSTLESLWFGVPVATWPMYAEQQLNAFTLVKELGLAVDLRMDYVSSRGGLVTCDEIARAVRSLMDGGDEKRKKVKEMADAARKALMDGGSSSLATARFIAELFEDGSSC

ID PTM Type Color
ph Phosphorylation X
sno S-nitrosylation X
so S-sulfenylation X
ac Acetylation X
mox Methionine Oxidation X
Multiple types X

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR035595 349 392
Sites
Show Type Position
Site 17
Site 127
Active Site 17
Active Site 390
Active Site 150
Active Site 350
Active Site 352
Active Site 367
Active Site 370
Active Site 371
Active Site 372
Active Site 375
Active Site 391
Active Site 392

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here